General Information

  • ID:  hor000196
  • Uniprot ID:  O61389
  • Protein name:  Molt-inhibiting hormone
  • Gene name:  NA
  • Organism:  Metacarcinus magister (Dungeness crab) (Cancer magister)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  medulla terminalis X-organ in the eyestalks
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Metacarcinus (genus), Cancridae (family), Cancroidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RVINDDCPNLIGNRDLYKRVEWICEDCSNIFRNTGMATLCRKNCFFNEDFLWCVYATERTEEMSQLRQWVGILGAGRE
  • Length:  78
  • Propeptide:  MMSRTESRYSSQRTWLLSMVVLAALWSISVQRATARVINDDCPNLIGNRDLYKRVEWICEDCSNIFRNTGMATLCRKNCFFNEDFLWCVYATERTEEMSQLRQWVGILGAGRE
  • Signal peptide:  MMSRTESRYSSQRTWLLSMVVLAALWSISVQRATA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-44; 24-40; 27-53
  • Structure ID:  AF-O61389-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000196_AF2.pdbhor000196_ESM.pdb

Physical Information

Mass: 1060213 Formula: C400H618N116O120S8
Absent amino acids: H Common amino acids: REN
pI: 4.74 Basic residues: 10
Polar residues: 26 Hydrophobic residues: 25
Hydrophobicity: -42.44 Boman Index: -18495
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 73.72
Instability Index: 4814.1 Extinction Coefficient cystines: 19855
Absorbance 280nm: 257.86

Literature

  • PubMed ID:  9548218
  • Title:  Molecular Cloning of a cDNA Encoding Molt-Inhibiting Hormone of the Crab, Cancer Magister